General Information

  • ID:  hor005498
  • Uniprot ID:  P83800
  • Protein name:  Crustacean hyperglycemic hormone
  • Gene name:  NA
  • Organism:  Astacus astacus (Noble crayfish) (Astacus fluviatilis)
  • Family:  arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Astacus (genus), Astacidae (family), Astacoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QVFDQACKGIYDRAIFKKLDRVCDDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVVDEYISGVQIV
  • Length:  72
  • Propeptide:  QVFDQACKGIYDRAIFKKLDRVCDDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVVDEYISGVQIV
  • Signal peptide:  NA
  • Modification:  T1 Pyrrolidone carboxylic acid;T3 D-phenylalanine;T72 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Control the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-43; 23-39; 26-52
  • Structure ID:  AF-P83800-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P83800-F1.pdbhor005498_AF2.pdbhor005498_ESM.pdb

Physical Information

Mass: 967533 Formula: C372H581N99O111S6
Absent amino acids: HMW Common amino acids: DV
pI: 4.9 Basic residues: 9
Polar residues: 21 Hydrophobic residues: 26
Hydrophobicity: -6.67 Boman Index: -13031
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 97.36
Instability Index: 1795.42 Extinction Coefficient cystines: 9315
Absorbance 280nm: 131.2

Literature

  • PubMed ID:  NA
  • Title:  NA